Recombinant Human C-C Motif Chemokine 4/CCL4 (C-6His)
500 ug
C569-500
1614 €
Human
P13236
8,87 kDa
Human cells
recombinants
Ambient/Room Temperature
Recombinants or rec. proteins
Greater than 95% as determined by reducing SDS-PAGE.
See included datasheet or contact us for more information.
Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
APMGSDPPTACCFSYTARKLPRNFVVDYYETSSLCSQPAVVFQTKRSKQVCADPSETWVQEYVYDLELNVDHHHHHH
Lyophilized from a 0.2 µm filtered solution of 20mM PB, 150mM NaCl, 5% Threhalose, pH 7.5.
Chemokines, chemokine receptors, ligands , motif chemokines and cytokines are supplied by novo in 1.
Recombinant Human C-C Motif Chemokine 4 is produced by our Mammalian expression system and the target gene encoding Ala24-Asn92 is expressed with a 6His tag at the C-terminus.
Lyophilized protein should be stored at below -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at below -20°C for 3 months.
Human proteins, cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies. Modern humans (Homo sapiens, primarily ssp. Homo sapiens sapiens). Depending on the epitopes used human ELISA kits can be cross reactive to many other species. Mainly analyzed are human serum, plasma, urine, saliva, human cell culture supernatants and biological samples.