Contact us on 02033938531 or vasil@gentaur.com.

Recombinant Human C-C Motif Chemokine 4/CCL4 (C-6His)

Basic information

Name

Recombinant Human C-C Motif Chemokine 4/CCL4 (C-6His)

size

50 ug

Catalog number

C569-50

Price

370 €

Details and extended information

Species reactivity

Human

UniProt number

P13236

Estimated molecular weight

8,87 kDa

Origin

Human cells

Group

recombinants

Shipping condition

Ambient/Room Temperature

Source

Recombinants or rec. proteins

Protein purity

Greater than 95% as determined by reducing SDS-PAGE.

Reconstitution conditions

See included datasheet or contact us for more information.

Endotoxin level

Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.

Peptide sequence

APMGSDPPTACCFSYTARKLPRNFVVDYYETSSLCSQPAVVFQTKRSKQVCADPSETWVQEYVYDLELNVDHHHHHH

Package form

Lyophilized from a 0.2 µm filtered solution of 20mM PB, 150mM NaCl, 5% Threhalose, pH 7.5.

Additional description

Chemokines, chemokine receptors, ligands , motif chemokines and cytokines are supplied by novo in 1.

Description

Recombinant Human C-C Motif Chemokine 4 is produced by our Mammalian expression system and the target gene encoding Ala24-Asn92 is expressed with a 6His tag at the C-terminus.

Storage conditions

Lyophilized protein should be stored at below -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at below -20°C for 3 months.

Properties

Human proteins, cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies. Modern humans (Homo sapiens, primarily ssp. Homo sapiens sapiens). Depending on the epitopes used human ELISA kits can be cross reactive to many other species. Mainly analyzed are human serum, plasma, urine, saliva, human cell culture supernatants and biological samples.