Contact us on 02033938531 or vasil@gentaur.com.

Recombinant Equine CCL3

Basic information

Name

Recombinant Equine CCL3

size

100 ug

Catalog number

RP0065E-100

Price

900 €

Details and extended information

Target

CCL3

Source

Yeast

Shipping

Ambient

Storage

-20 °C

MW

7.8 kDa

Product Type

Protein

Entrez Gene ID

100057909

Form

Lyophilized

Alias'

MIP-1 alpha

Group

recombinants

Additional source

Recombinants or rec. proteins

Protein Sequence

VPFGADTPTACCFSYVSRQIPRKFINDYYETSSQCSKPAIIFQTKRSRQVCADPSEAWVQEYVTDLELSA