Contact us on 02033938531 or vasil@gentaur.com.

Recombinant Chicken CCL4

Basic information

Name

Recombinant Chicken CCL4

size

25 ug

Catalog number

RP0064C-025

Price

400 €

Details and extended information

Target

CCL4

Source

Yeast

Entrez Gene ID

395551

Shipping

Ambient

Storage

-20 °C

MW

7.8 kDa

Product Type

Protein

Alias'

MIP-1 beta

Form

Lyophilized

Group

recombinants

Additional source

Recombinants or rec. proteins

Protein Sequence

APVGSDPPTSCCFTYISRQLPFSFVADYYETNSQCPHAGVVFITRKGREVCANPENDWVQDYMNKMELN

Properties

Chickens like all bird species have IgY antibodies that are very stable and found in the yolk. Gallus Gallus domestica is the Latin name of the Chicken.