Contact us on 02033938531 or uk@gentaur.com.

Recombinant Mouse C-C Motif Chemokine 3/CCL3/MIP-1a(N-6His)

Basic information

Name

Recombinant Mouse C-C Motif Chemokine 3/CCL3/MIP-1a(N-6His)

size

50 ug

Catalog number

CR13-50

Price

497 €

Details and extended information

Species reactivity

Mouse

UniProt number

P10855

Estimated molecular weight

10,8 kDa

Group

recombinants

Latin name

Mus musculus

Origin

Escherichia coli

Shipping condition

Ambient/Room Temperature

Source

Recombinants or rec. proteins

Protein purity

Greater than 95% as determined by reducing SDS-PAGE.

Endotoxin level

Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.

Peptide sequence

MGSSHHHHHHSSGLVPRGSHMDDDDKAPYGADTPTACCFSYSRKIPRQFIVDYFETSSLCSQPGVIFLTKRNRQICADSKETWVQEYITDLELNA

Package form

Lyophilized from a 0.2 µm filtered solution of 20mM Tris,150mM NaCl,5%Trehalose,1mM EDTA,pH8.0.

Additional description

Chemokines, chemokine receptors, ligands , motif chemokines and cytokines are supplied by novo in 1.

Description

Recombinant Mouse C-C Motif Chemokine 3 is produced by our E.coli expression system and the target gene encoding Ala24-Ala92 is expressed with a 6His tag at the N-terminus.

Storage conditions

Lyophilized protein should be stored at below -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at below -20°C for 3 months.

Reconstitution conditions

Always centrifuge tubes before opening. Do not mix by vortex or pipetting.It is not recommended to reconstitute to a concentration less than 100 µg/ml.Dissolve the lyophilized protein in ddH3O.Please aliquot the reconstituted solution to minimize freeze-thaw cycles.

Test

Mouse or mice from the Mus musculus species are used for production of mouse monoclonal antibodies or mabs and as research model for humans in your lab. Mouse are mature after 40 days for females and 55 days for males. The female mice are pregnant only 20 days and can give birth to 10 litters of 6-8 mice a year. Transgenic, knock-out, congenic and inbread strains are known for C57BL/6, A/J, BALB/c, SCID while the CD-1 is outbred as strain.