Recombinant Mouse C-C Motif Chemokine 3/CCL3/MIP-1a(N-6His)
50 ug
CR13-50
497 €
Mouse
P10855
10,8 kDa
recombinants
Mus musculus
Escherichia coli
Ambient/Room Temperature
Recombinants or rec. proteins
Greater than 95% as determined by reducing SDS-PAGE.
Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
MGSSHHHHHHSSGLVPRGSHMDDDDKAPYGADTPTACCFSYSRKIPRQFIVDYFETSSLCSQPGVIFLTKRNRQICADSKETWVQEYITDLELNA
Lyophilized from a 0.2 µm filtered solution of 20mM Tris,150mM NaCl,5%Trehalose,1mM EDTA,pH8.0.
Chemokines, chemokine receptors, ligands , motif chemokines and cytokines are supplied by novo in 1.
Recombinant Mouse C-C Motif Chemokine 3 is produced by our E.coli expression system and the target gene encoding Ala24-Ala92 is expressed with a 6His tag at the N-terminus.
Lyophilized protein should be stored at below -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at below -20°C for 3 months.
Always centrifuge tubes before opening. Do not mix by vortex or pipetting.It is not recommended to reconstitute to a concentration less than 100 µg/ml.Dissolve the lyophilized protein in ddH3O.Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Mouse or mice from the Mus musculus species are used for production of mouse monoclonal antibodies or mabs and as research model for humans in your lab. Mouse are mature after 40 days for females and 55 days for males. The female mice are pregnant only 20 days and can give birth to 10 litters of 6-8 mice a year. Transgenic, knock-out, congenic and inbread strains are known for C57BL/6, A/J, BALB/c, SCID while the CD-1 is outbred as strain.